SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d4pe0a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4pe0a_
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 2.47e-24
Family S100 proteins 0.0000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d4pe0a_
Sequence length 92
Comment a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Download sequence
Identical sequences A0A0C5GTC2 L8I8R6 P02638
NP_001029727.1.59421 NP_001029727.1.76553 XP_005902390.1.15283 XP_006047095.1.26621 XP_010833159.1.44457 XP_019819353.1.53367 000048924|e1cfpA1|108.1.1.146|A:1-92 000048932|e1cfpB1|108.1.1.146|B:1-92 001400644|e4pe7A1|108.1.1.146|A:1-92 001406067|e4pe0A1|108.1.1.146|A:1-92 cath|current|1cfpA00/0-91 cath|current|1cfpB00/0-91 cath|current|3cr2A00/0-89 cath|current|3cr4X00/0-89 cath|current|3cr5X00/0-90 cath|current|3gk1A00/1-88 cath|current|3gk2A00/1-88 cath|current|3gk4X00/0-89 cath|current|3iqoA00/1-88 cath|current|3iqoB00/1-88 cath|current|3iqqA00/0-88 cath|current|3lleA00/0-89 cath|current|3lleB00/0-89 cath|current|4pdzA00/0-89 cath|current|4pdzB00/1-89 cath|current|4pe0A00/0-91 cath|current|4pe0X00/0-88 cath|current|4pe1A00/0-88 cath|current|4pe1B00/0-89 cath|current|4pe4A00/0-89 cath|current|4pe4X00/0-89 cath|current|4pe7A00/0-91 d1cfpa_ d1cfpb_ d4pe0a_ d4pe7a_ 1cfp_A 1cfp_B 3cr2_A 3cr4_X 3cr5_X 3gk1_A 3gk2_A 3gk4_X 3iqo_A 3iqo_B 3iqq_A 3lle_A 3lle_B 4pdz_A 4pdz_B 4pe0_A 4pe0_X 4pe1_A 4pe1_B 4pe4_A 4pe4_X 4pe7_A 5dkn_A 5dkq_A 5dkr_A 5dkr_B 5er4_X 5er5_A ENSBTAP00000006275 9913.ENSBTAP00000006275 ENSBTAP00000006275 3cr5X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]