SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436833408|ref|YP_007318624.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436833408|ref|YP_007318624.1|
Domain Number 1 Region: 324-460
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-22
Family PDI-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|436833408|ref|YP_007318624.1|
Sequence length 490
Comment alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Fibrella aestuarina BUZ 2]
Sequence
MNVRNYCMLLLGLGLGVVSLLASAQSPEGHRIAGRIRGLKDTTVVLAHYQYDATHYVPKD
TARVDAGGNFVFQSRKKLPEGLYLVVLPKGRYFDLMLAEQQFSFETDTTDLIGSLKSAGS
VENAAFYGYQHKLKSIFDQMGKLDKLPKSDVTAQQMKALQTEAATYRKEFLAKNPKLLTS
KILLASADPDVPAPPKAANGRPDSIWQFNYYKNHFWDNFDLTDDRMLRTSLLQPRIDRYI
KELTFQQVDSLTKEADMLIKRAGPSKDMRNYLIWYLTSQYERPKVLGTDGLFIHLVENYW
LKGQFDNLDSTTRKTLTERVAILKPLQVGKPFQMPVVGDTLTRPINLAQATTGADYTVMF
FYAPHCGHCREAAPKVKQFTDSPAGKGVKVVAVAIEDSADDWKKFIREFKLTNWVNGYDH
SQRIDFRRQYDVYSTPTVYVLDKNRKIIARALPAEDIGNFIEFSRKQAASKAPAASATTK
PAPKQKVSGR
Download sequence
Identical sequences I0K1M8
WP_015329131.1.89626 gi|436833408|ref|YP_007318624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]