SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436833861|ref|YP_007319077.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436833861|ref|YP_007319077.1|
Domain Number 1 Region: 243-381
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-36
Family Glutathione peroxidase-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|436833861|ref|YP_007319077.1|
Domain Number - Region: 130-199
Classification Level Classification E-value
Superfamily Cobalamin adenosyltransferase-like 0.0432
Family Cobalamin adenosyltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436833861|ref|YP_007319077.1|
Sequence length 384
Comment Thiol-disulfide oxidoreductase resA [Fibrella aestuarina BUZ 2]
Sequence
MKQFVLSTVTSLTCCLFSVAANAQATKPSTVTGQIAMATPGSKVYLESNTNPAVRLDSAV
VTADKQFTLKTNVPEGGNIYLVNMGVIKEKAAVLLEGGETLTVLAEPGVKPKAKNAPPAK
PKITVTGTKSNDLFRTLLQLQNDIRDKGTDLMKSYQEAQARNDAKSMSQIEQTYDGLAAE
TTKKVKAMLPELGTSLAALYATNFLNPETDFPTLDTLARKFEQAGISSPHAKSFIGNIAR
IRGLSVGAEAPEIALTDTNGTTVPLSSLRGKLVLVDFWASWCGPCRNENPNVVRMYNKFK
DKGFAIYSVSLDRPGQREAWVRAIRNDGLTWTHVSDLKYWQSEAAQRYGVSAIPATFLID
KEGKIVAKNLRGDALEAKLTEILQ
Download sequence
Identical sequences I0K2Y1
WP_015329584.1.89626 gi|436833861|ref|YP_007319077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]