SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436834263|ref|YP_007319479.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436834263|ref|YP_007319479.1|
Domain Number 1 Region: 614-766
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-26
Family Thioltransferase 0.027
Further Details:      
 
Weak hits

Sequence:  gi|436834263|ref|YP_007319479.1|
Domain Number - Region: 129-164
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.034
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|436834263|ref|YP_007319479.1|
Sequence length 769
Comment cytochrome c biogenesis protein transmembrane region [Fibrella aestuarina BUZ 2]
Sequence
MTRFSPHPNRLSRLLLSSLIWLSMVGMTSQLAVAQIRKDPTRWTISGPAKPAKIGDVVEL
TIQASIAESWHIYSPDLDPNIGPIPTSIKFKPSAAYKLVGAPVPVGVQEIYVEVWGAKVR
QFEGKAIIRQKVKVLADNPTIELTTEYQACSDKDGTCLPPAEAELQTIVKTTAAVTSPSS
TTAGKRVGNVPAVKTETVAPVASATEPSPADLATATTSAVTDTDTLTQQAETRASAQASL
AATPVEGQGQSLWAFALAAFLAGLAALLTPCVFPIIPMTVSFFTNQKGGSWKALLYGASI
IGIYVLIGTVVSRINGPGFANFVSTHWLPNLLFFAVFFVFGLSFLGLFEITLPSSIVNRA
DAASERGGLAGIFFMAFTLVLVSFSCTGPIVGSLLVASAGGEVVKPIVGMAAFSSAFAIP
FTLFALFPQWLQKLPKSGGWLNAVKVVLGFLELALALKFLSIADQVYHWHLLDREVYLAF
WIVIFSMLGFYLLGKLKLPHDSAPVSTGKLNLREFAIRGVMNQPVGALVDSDAAGQLTLT
GTPTSGTVQLTGGNDTKVSIPRLLLAIVTFTFVVYMVPGMWGAPLNALAGYLPPLATQDF
ISRGGPASATTQQSTAVRHGNLFKLPHGLPGFFDYKEALAYSKTVKKPVFIDFTGHGCVN
CREMEQRVWSDPKVLSRLQNDYVVVALYVDDKTELPEAEWYTSGYDQKTKKTIGAQNADL
QVVKYNNNAQPHYCLVDGTGTLLVSPINYNLSVDKFVAFLDAGKAAFGK
Download sequence
Identical sequences I0K433
gi|436834263|ref|YP_007319479.1| WP_015329986.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]