SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436836220|ref|YP_007321436.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436836220|ref|YP_007321436.1|
Domain Number 1 Region: 498-622
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.29e-21
Family Glutathione peroxidase-like 0.024
Further Details:      
 
Weak hits

Sequence:  gi|436836220|ref|YP_007321436.1|
Domain Number - Region: 389-449
Classification Level Classification E-value
Superfamily HCP-like 0.000732
Family HCP-like 0.033
Further Details:      
 
Domain Number - Region: 157-460
Classification Level Classification E-value
Superfamily TPR-like 0.0329
Family Tetratricopeptide repeat (TPR) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436836220|ref|YP_007321436.1|
Sequence length 642
Comment alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Fibrella aestuarina BUZ 2]
Sequence
MSIMVSMKWILLFYLLINIFALRQAICQESSNLTFDWIQGKDSSSVGVNYHDKMNLFSST
DSLYIIYYLNKRFTKEPSAFEKKCVFRDNKWYANIVVPNDAVSLMLIVKNENNKLDNNKG
TGYWLPVTHDGVVSEGAYATIAYMYAGAWEAPNYNLSTQRDSARILFEQEFTLYPQSKRF
YHRYYLSTLSKSGEKYKSELSMFESYNDLDQWELLMLTDLYKYKNNVEKTRFFNDRLFKT
YPGGFWSMQINSMPLQKAFSGTDDMVKKRKAYEEFKEKYKTFEDDDTRRYIELRKGITML
SRLLPHFVEYDLEKEWLADVNELSDEFKIPTLAFGARSLNSNGNGLVAEKYAKMAVELMK
MYLDTNVRKVTERLYYTDKEVRNIRESLLADYLYIYGHSLFLQKKYEQADTVLQQAALKY
AKSTDITKNKLYLRCLIEAKQYKKAQSVMRGFMKRGKVDKEMDELMINLPIADGDKYDAE
EAVKYVIRDKIRANIIRENIPDMVFRNSLGEKVSLSSYKGKIVILDFWASWCAPCIAGLG
VLDKFRADNKLDDKVVIVCVNTLEYDLKGRNRANEIMASRNYSLVSLFDELNEAPKQARF
TALPTRVFIDQSGQVRYRQTGIEGSETEQLAELAVIVGEIRK
Download sequence
Identical sequences I0K9P0
WP_015331942.1.89626 gi|436836220|ref|YP_007321436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]