SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436838153|ref|YP_007323369.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436838153|ref|YP_007323369.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.04e-44
Family Glutathione peroxidase-like 0.000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436838153|ref|YP_007323369.1|
Sequence length 153
Comment alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Fibrella aestuarina BUZ 2]
Sequence
MALTVGQQAPAFTLFSSDKKEVSLADYAGRNVVLLFFPMAFTSVCTAELCEMRDNLHVYQ
NLNADVLAISVDSPFTLDKFKAEQNLPFPLLSDFNKEVSAAYGALYDTFVMNMHGVSKRA
AFVVGTDGALKYTEVLDNAGNVPNFTAIQAALN
Download sequence
Identical sequences I0KF73
WP_015333875.1.89626 gi|436838153|ref|YP_007323369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]