SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436838781|ref|YP_007323997.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436838781|ref|YP_007323997.1|
Domain Number 1 Region: 261-409
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-23
Family Glutathione peroxidase-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|436838781|ref|YP_007323997.1|
Sequence length 420
Comment alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Fibrella aestuarina BUZ 2]
Sequence
MTFRFSYLTFFFLVPLLVNCQSAPALKTGTWRATLQTSGGELPFGLDIQPAAEAGRYTVH
AINGTERLAMDEAYVQNDSLHIPMLVFESELVGRVNGDRMTGVWRKRRTGNQYQIVPFTA
QFGQAFRFAPRSGTSAGQSASRTVTGKWQTLFRATEGDTTIAVGVFSQQNGTVSGTFLTP
TGDYRYLAGNVFGDSLFLSCFDGTHAFLFKAKLTKPQASAEQTMTGVFHSGPTYRETWTA
RLEPNAALPDPGKLTFVKPGQAFMFTFPDAQGKILSLNDPRFKGKVTVVQILGTWCPNCM
DETRFLAPWYAKNRSRKVEVVGLAFEKTADLTESGPKIKRMAERFGVTYPVLLAGTNDKA
EASKALPALNRVVAFPTTIFLDKKGQVRHIHTGFSGPGTGAYYDEYVAEFNRLVDKLEQE
Download sequence
Identical sequences I0KH01
gi|436838781|ref|YP_007323997.1| WP_015334501.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]