SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21218879|ref|NP_624658.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21218879|ref|NP_624658.1|
Domain Number - Region: 56-101
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00267
Family Ricin B-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21218879|ref|NP_624658.1|
Sequence length 114
Comment hypothetical protein SCO0334 [Streptomyces coelicolor A3(2)]
Sequence
MLQLAGTTAATTAVGPLAGGSPAHGAALPPARAGIGAPAFPFGLGRVRPTATLLDQGDGT
CTIRDARGKLLPVQNDSPAAGAFVAQEADDGAADNRWRILRRTAIDTRVRVVPG
Download sequence
Identical sequences A0A1H1RRQ0 Q9RK45
NP_624658.1.49638 WP_011027027.1.58943 100226.SCO0334 gi|21218879|ref|NP_624658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]