SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21220479|ref|NP_626258.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21220479|ref|NP_626258.1|
Domain Number 1 Region: 25-277
Classification Level Classification E-value
Superfamily Cgl1923-like 8.63e-71
Family Cgl1923-like 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21220479|ref|NP_626258.1|
Sequence length 312
Comment hypothetical protein SCO1997 [Streptomyces coelicolor A3(2)]
Sequence
MLDPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQV
VARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWE
RFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPGHRSPFEEAQVPG
SAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLR
TDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAAGAETRGNMLAEPVEIPSADEIGRE
FERFLAEREGDG
Download sequence
Identical sequences A0A1H1YAZ7 D6EKC1 Q9S2K6
APC7372 gi|21220479|ref|NP_626258.1| 100226.SCO1997 NP_626258.1.49638 WP_003976821.1.26049 WP_003976821.1.30910 WP_003976821.1.43399 WP_003976821.1.55229 WP_003976821.1.58943 WP_003976821.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]