SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21221433|ref|NP_627212.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21221433|ref|NP_627212.1|
Domain Number 1 Region: 70-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000138
Family Thioltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21221433|ref|NP_627212.1|
Sequence length 145
Comment hypothetical protein SCO2989 [Streptomyces coelicolor A3(2)]
Sequence
MRRAWTGPVLLLIAGAGAATGPIVQGRPGTGAVLSVVFVLLAGLTSPLVFPRSVGALEAR
RRSAADGRPVVFWRPGCTYCLRLRLRLGRRARRLHWVDIWRDEAGAEAVREVNDGNETVP
TLLVAGRAYTNPDPAWVREQVSSTR
Download sequence
Identical sequences A0A1H2AWR5 D6EV27 Q9L046
100226.SCO2989 NP_627212.1.49638 WP_003975822.1.26049 WP_003975822.1.30910 WP_003975822.1.43399 WP_003975822.1.55229 WP_003975822.1.58943 WP_003975822.1.86682 gi|21221433|ref|NP_627212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]