SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21221753|ref|NP_627532.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21221753|ref|NP_627532.1|
Domain Number 1 Region: 44-259
Classification Level Classification E-value
Superfamily HAD-like 1.6e-29
Family Phosphoserine phosphatase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21221753|ref|NP_627532.1|
Sequence length 298
Comment hypothetical protein SCO3322 [Streptomyces coelicolor A3(2)]
Sequence
MLAGEASAEAARKSAEAAETAGTSQETTPGSGVAEPEFPVHGDDRAAAFFDLDNTVMQGA
AIFHFGRGLYKRKFFETRDLARFAWQQAWFRLAGFEDPEHMQDARDSALSIVKGHRVSEL
KSIGEEIYDEYMAERIWPGTRALAQAHLDAGQKVWLVTAAPVEIAQVIARRLGLTGALGT
VAESIGGVYTGKLVGEPLHGPAKAEAVRALATAEALDLSRCAAYGDSHNDIPMLSLVGHP
YAINPDSKLRKHARELEWRLRDYRTGRKAAKVGIPAAAGVGAVAGGTAAAIALHRRRR
Download sequence
Identical sequences Q9WX12
gi|21221753|ref|NP_627532.1| 100226.SCO3322 APC68134.0 NP_627532.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]