SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21223779|ref|NP_629558.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21223779|ref|NP_629558.1|
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-30
Family Thioltransferase 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|21223779|ref|NP_629558.1|
Domain Number - Region: 180-270
Classification Level Classification E-value
Superfamily TPR-like 0.000321
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21223779|ref|NP_629558.1|
Sequence length 318
Comment thioredoxin [Streptomyces coelicolor A3(2)]
Sequence
MSGVVDLAAVKQAQEAKAKAEQARAEAARTGGAGAVSPADLVIDVDEAGFESDVLQRSTE
VPVVIDFWAEWCEPCKQLSPVLERLAVEYNGRFLLAKIDVDANQMLMQQFGVQGIPAVFA
VVAGQALPLFQGAAGEQQIRQTLDQLVQVGEERFGLTGLVVDPEAEPGAERPAAPERPAG
PHDAALDAAVQAMDAGDLGGAVQAYKNVLAEEPGNTEAKLGLAQAELLQRVQDADPQKVR
REAADKPGDAQAQIAAADLDLVGGHVEDAFGRLIDTVRVTAGDDRDAVRLRLLELFEVVG
ADDPRVAAARRALARALF
Download sequence
Identical sequences Q9L2A3
gi|21223779|ref|NP_629558.1| 100226.SCO5419 NP_629558.1.49638 WP_011030234.1.26049 WP_011030234.1.55229 WP_011030234.1.58943 WP_011030234.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]