SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21224847|ref|NP_630626.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21224847|ref|NP_630626.1|
Domain Number 1 Region: 41-446
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.75e-88
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000431
Further Details:      
 
Domain Number 2 Region: 457-765
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.06e-39
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000253
Further Details:      
 
Domain Number 3 Region: 780-886
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.86e-34
Family Cellulose-binding domain family II 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21224847|ref|NP_630626.1|
Sequence length 890
Comment cellulase [Streptomyces coelicolor A3(2)]
Sequence
MRRTRILTVLLALAAGLLAGSPPAASAAEPAPRAAVAADSYTWKNARIDGGGFVPGIVFN
RTEKDLAYARTDIGGAYRWQEESHTWTPLLDHVGWDDWGHTGVVALASDAVDPDRVYAAV
GTYTNDWDPTNGAVLRSADRGASWEKADLPFKLGGNMPGRGMGERLAVDPHDNDVLYLGA
PSGHGLWRSTDAGVTWSEVTAFPNPGNYAQDPNDTSGYASDNQGITWVTFDESTGGGAGT
ATRTLYVGVADKENAVYRSTDAGATWERLAGQPTGYLAHKGVLDAENGYLYLAYSDTGGP
YDGGKGRLYRYATATGTWTDISPAAEADTYYGFSGLTVDRQRPGTVMATAYSSWWPDTQI
FRSTDSGATWSQAWSYTSYPDRENRYTMDVSSSPWLTWGANPAPPEQTPKLGWMTEALEI
DPFDSDRMMYGTGATVYGTENLTNWDDEGGTFAVEPMVRGLEETAVNDLASPPSGAPLLS
ALGDVGGFRHTSLTEVPSMMYTSPNFTSTTSLDFAETKPDVVVRAGNLDSGPHIAFSTDN
GANWFGGTDPSGVSGGGTVAAGADGSRFVWSPEGAGVQYTTGFGTSWQASTGLPAGAIVE
SDRVNPATFYGFKSGRFYVSTDGGATFTASAATGLPAGDGVRFKALPGGEGDVWLAGGAA
DGPYGLWHSTDGGGTFTRLPGVDAADTVGFGKAAPGASYQTLFTSAEIGGVRGIFRSTDA
GATWTRVNDDAHQWGWTGAAITGDPRVYGRVYVATNGRGVIYGDTSDTGGGTDPGPGPDP
TPTGACEVTYTVTNQWPGGFQADVRLTNTGTSAWNGWSLDWSFPGGQEVTRMWNAEHTQA
GTSVTARNVGWNAGVAPGASVGFGFTGSRSGTNAEPEGFAVAGRACPTAT
Download sequence
Identical sequences O86727
gi|21224847|ref|NP_630626.1| NP_630626.1.49638 100226.SCO6545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]