SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21225017|ref|NP_630796.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225017|ref|NP_630796.1|
Domain Number 1 Region: 33-316
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.42e-40
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21225017|ref|NP_630796.1|
Sequence length 348
Comment oxidoreductase [Streptomyces coelicolor A3(2)]
Sequence
MALAGAVCAAALAALTAVPAQAHQRPQWDVQDTGVFDVRFRGLAAVSRHTAWVAGTGGTV
LRTTDGGDTWRDVSPPGAGELEFRDIEAFDARRAVVLAIGEGEASRIYRTDDGGATWTES
FRNTDARAFYDCLTFFDRRHGLAMSDPVDGKFRILSTGDGGRSWKVLPDAGMPAAQQGEA
GFAASGQCLVSAGPSDVWLATGGAARARVLHSADRGRTWTATDAPVPAGDPARGVFALAF
RDAAHGLAVGGDYRPGQASPRAAARSSDAGRSWRPADRPPPAYRSGVAWLPHSRSAALAV
GPTGTDLTTDGGRTWRTVDTGSYDTVDCTPDLGCWAAGEQGRVARLER
Download sequence
Identical sequences Q9X7M9
gi|21225017|ref|NP_630796.1| 100226.SCO6723 NP_630796.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]