SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32141230|ref|NP_733631.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32141230|ref|NP_733631.1|
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily PhoU-like 1.15e-58
Family PhoU-like 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32141230|ref|NP_733631.1|
Sequence length 229
Comment phosphate transport system regulator, partial [Streptomyces coelicolor A3(2)]
Sequence
MRDAYHEELDSIGDGLVEMARLVGSAIGRATTAILDSDLKLAEAVIEADQKVDNLQHELE
ARAITLLARQQPVATDLRIVVTSLRMSADLERSGDLAQHVAKLARLRYPERAVPHDLHAT
ILEMGQLAQRLMAKAAEVIITKDVDLALQLEQDDDAMDLLHRTLFQHLMDDRWKHGIETA
VDVTLLGRYYERFADHAVSVAKRVVYLVTGEHADDLQADIQPATQVEGA
Download sequence
Identical sequences A0A1H2CE82 D6EJY7 Q8CJU3
gi|32141230|ref|NP_733631.1| NP_733631.1.49638 WP_003974747.1.26049 WP_003974747.1.30910 WP_003974747.1.43399 WP_003974747.1.55229 WP_003974747.1.58943 WP_003974747.1.86682 100226.SCO4228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]