SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|127386|estExt_fgenesh1_pg.C_10366 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|127386|estExt_fgenesh1_pg.C_10366
Domain Number 1 Region: 123-188,290-412
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 394-492
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.35e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 3 Region: 16-57
Classification Level Classification E-value
Superfamily PH domain-like 0.00000356
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|127386|estExt_fgenesh1_pg.C_10366
Sequence length 536
Sequence
MRLTLLLLTVDDQNHVRHPGNYVFVLQTPSRKLFLSATTEQERRCWVTELRGLLSGGYDG
VDRTVLDSAILGRNPSSAAKTSTAAATVLNNQKKAHKRASKERKAERRRQQLPKLKRTFT
ETWLDEVFVQPSGSTREDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFNICKAR
AQAVLMEMSLKRDVDHSVVETPTASSGASTSVILESPGRSVSSTNAEDSEGPVASEDSAT
VQTTVSAKPSAAMDVATTGKTSPLKEISDRKRARRSSAVLPVQNMLQDAVGIAEMLVAHG
ERSIKLVNVDMPRTFGHHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQGMSYLAATLCF
HMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEYELPALAAHFQEIGIDA
QMYAVDWALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAEDIM
RLLHNFPKNTSSRQLFEAISSVSLSCQEITELLAGGKLWSPDEARQVPVKFPETYE
Download sequence
Identical sequences jgi|Physo1_1|127386|estExt_fgenesh1_pg.C_10366 67593.JGI127386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]