SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|127586|estExt_fgenesh1_pg.C_20162 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|127586|estExt_fgenesh1_pg.C_20162
Domain Number 1 Region: 133-273
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-18
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 2 Region: 248-352
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-17
Family Ypt/Rab-GAP domain of gyp1p 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|127586|estExt_fgenesh1_pg.C_20162
Domain Number - Region: 29-75
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0115
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|127586|estExt_fgenesh1_pg.C_20162
Sequence length 401
Sequence
MAIPLALVSAATSARAAAAPPDAEPMEANAFCQCCQVACHRFRPAKPCSFCHALVCQFCS
CGNEPHVLCKSCQPQVRGAQPAFSFRQLLWRFKMLPFGCHGEKWLFLVRKRQSLVVPTDL
SGDEYQWLVHQLPRQRRLQGAHLEQKRTLDRDIDRTFQQLQARMANNKRPNFLVKSQHSS
SEFMAWKSSTHQLLSVFMMLKPQIGYCQGMTSVAAVLVQESKMNSEIAFRLFLALTEKYR
LDDVYRPDMKDVNLRYFQLDEALRLHLPRLHAHLSDRDIHPSTYASCWILTLFTECRLFP
HRYVIAFLDLFFEFGWKVFFQTCLAILSTIEAALLRRSTSGDIFAYLAKVTWFHRHKSDN
DLGRFFATARTFNISSSFLDVLQGEYSTEASMSMNDYDYSS
Download sequence
Identical sequences G4Z3S8
67593.JGI127586 jgi|Physo1_1|127586|estExt_fgenesh1_pg.C_20162 XP_009523504.1.77131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]