SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|127782|estExt_fgenesh1_pg.C_20358 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|127782|estExt_fgenesh1_pg.C_20358
Domain Number 1 Region: 112-275
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0046
Further Details:      
 
Domain Number 2 Region: 251-368
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-35
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|127782|estExt_fgenesh1_pg.C_20358
Sequence length 386
Sequence
MLEKNVMGPEDAERSAVRDKSDAADRETPAPSPPDGEEAKADVTETEAKVLAVAFPMAPI
DRYGFLVTDKRYNGGHTAPNAYKHAVWLENRRTQKWVKMIGKQLEDWEVCQLRYAATLKK
RIRKGIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQTARVPCEETIARDIGRTFPRHSL
FRDRSSLGQCALMNVLKAYSLHDPEVGYCQGMGFLSAMFLCYMPEQQAFWLLVACLNHKR
YGLADLYRPRMPKVPEVTFVFQGLFKQIMPQLSAHLENEGLHPTMYLTQWFLTLFTYNFP
FEFVTRVWDAFLHEGWKVIYRVALALLKVSQKTLLSSKFETIMEYFRDLPNKVDSDEVLT
AAFRLPIKRSQITHMLEKYHSSSAAS
Download sequence
Identical sequences 67593.JGI127782 jgi|Physo1_1|127782|estExt_fgenesh1_pg.C_20358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]