SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|130134|estExt_fgenesh1_pg.C_100092 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|130134|estExt_fgenesh1_pg.C_100092
Domain Number 1 Region: 701-1089
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-126
Family Myotubularin-like phosphatases 0.0000000256
Further Details:      
 
Domain Number 2 Region: 232-362
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-23
Family Ypt/Rab-GAP domain of gyp1p 0.0035
Further Details:      
 
Domain Number 3 Region: 4-38,65-176
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.54e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0023
Further Details:      
 
Domain Number 4 Region: 548-692
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000221
Family GRAM domain 0.058
Further Details:      
 
Domain Number 5 Region: 458-506
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000561
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|130134|estExt_fgenesh1_pg.C_100092
Sequence length 1101
Sequence
MDTSRGARWAAALGLRGDVLAAQRERYERLKQHLVFQIDAAGITDPLSAIAAATDAASSS
HDHGHDHSWSQYFTDEGLLEEINTDLDRLFPAGNEGFFQNEIYLSTLRHVLFVWCRLHPD
VAYRQGMHDVVAVVLYAFLQDQEEQETEVIEEKKLRQHAEADTFLVFEAVMLFLKPFYEI
VKTRPEAPTGSAARDGSRLFDNFTLKENDAGNAAYGLQTRDGGKQPALHRLCHHVQYELL
QQKDPQLYYHLQNLEIVPETYCLRWIRLLFAREYALKELLCIWDAMILDASREAIDFPKI
NMTDKSDNDLLQLPKLVTKNEDASWIGFPLLRYICVARLLQMSSLLRQSDNTGCLRLLMR
AYQEEEANGSGLERKTQALELTKFAKILQNPMMEETQHKNTVGSNEENGEKDTFGEIEVV
QFQEGSLGIILTAAGAPFEDRLAVKSFTKDPTSSDGVGQAEASDKVHLGDLLQSINGVPI
VGVTTEEVKRRLQLIDRPIYMGFCHCGEAYGDADVTTSEDSEAVDASDATGSSLATDTAL
SELVQPVFLPGELCYANVETSMQRLVLSHDGSCLSHYISGKLFITNYRCFFTRLLGRGEI
DWQIPVLSIASIDRVDPRAIPLGTGATGLSLENVQVALGFVPDDSYKVVIRCKDTQVARL
SISDHGEYSKLVKCLSFLAFPKSLLDAFCFAYSPTVAPSEEVQFDIRQEYGRIGLLSMPD
HLRCIDQSPKYTLCDTYPRHLIVPADISDVRLKAAATFRSHQRLPVVSWIHRDNGATIVR
SSQPLVGLKSARSGEDELLVQLLCCSSNKKAFGRYVIMDARSQLAAVGNKAMGKGTEISS
NYRGAKLMFMNVENIHSVRQSQLALAAIFEPKKSASEDTSSSFYGRIDSSGWLRHVRLLL
KASVELAHTVNSGTSVLTHCSDGWDRTAQMVALAELMLDPYYRTLRGFQVLVEKEWCSFG
HQFALRSGHARSDVSNEQRSPVFLLWLDCVWQYIRQYPTECEFNESFLLTLADHVYSCKF
GTFMFDCERQRKDFFAKHRVFSIWSEINSQSERFTNHMYAPSDQATVLSPSTLSKNIKLW
KGYFCRWDPTVIPPVPAFQCY
Download sequence
Identical sequences jgi|Physo1_1|130134|estExt_fgenesh1_pg.C_100092 67593.JGI130134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]