SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|130211|estExt_fgenesh1_pg.C_100169 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|130211|estExt_fgenesh1_pg.C_100169
Domain Number 1 Region: 23-55,103-190
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-28
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 165-268
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-23
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|130211|estExt_fgenesh1_pg.C_100169
Sequence length 297
Sequence
MYDQLLEKVGTKLAGGLDAEEDSLSDDDAQLAVWFREIDVDVVRTCHRRIYTNNTATLVT
STSDSDEDTVESVLNEMIDIVVKGEGGSSSHQPVASSSTRNTDLEAKIRRVLRAYVVYNP
RVGYCQGMGFLVRLLTEVAEDEADIFWLFVGFSEPENDRNLYEPGMAVLQPYLSKFELLF
STHMPELYAHFQAEGVHVATFCTRWFLTFFSSFETLAPNLVIRLLDIFIIDGWRVMFSVS
LVILDELQEQLMKCDMEGILRVLQFPRSYMPDPDQLRQRQLVRHALAFSISRAINSI
Download sequence
Identical sequences 67593.JGI130211 jgi|Physo1_1|130211|estExt_fgenesh1_pg.C_100169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]