SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|131927|estExt_fgenesh1_pg.C_180036 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|131927|estExt_fgenesh1_pg.C_180036
Domain Number 1 Region: 207-333,444-462
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-22
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 496-607
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-22
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 
Domain Number 3 Region: 45-150
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000274
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|131927|estExt_fgenesh1_pg.C_180036
Sequence length 623
Sequence
MDMEVLRFPLSSPSARAPANANVWERLLQTFAVPAPTAHRFLPKLKAGPLLLEVGQPPEW
KPFEVVLAGASAADLGLYYYPHKEDATPMGCIRLQSAHIDSLEEVLMVVAKDKTWFLCAD
HVRDASDWCDAICSAIERVSNRDGAATQHQLQERRRRLNSSASAVTLCELQSRGAKARVD
EFLEVFVRSTREDMCLQAAKGALSWSCMRSLAWKVWLECIPADVPFSQWVVIARDKRQRY
EKLRKKQNLFQDLLVGKQRPEDLLTMCETSTDSLLYSIYKDVRRTRGDMPYFRDPVVQCL
LIRVLYVYSATHSEISYNQGMGELLATLVYLLHIEQWPTDEDDIEEVIAGEHDAEPDGRL
SGSYFFPATSPTKEQAEDTSTEEEDTSYVYVESFINIQNDDSFLDRDTFLRLAPFAGGSG
RYYECCRDAAGEIVRELTASEFIEHDAYLLLEEMMLRMAGTYCPHVRIPRRNSRSEKPLS
SADQLPPSPLDDQMNRIHHHILSRCDPPTARHLAKLGVEPQIFLLRWVRVLMAREFETPQ
VWQIWDAIFSLTPSDFSFINLLCVAVVREFREEILAAEDATNVLLSLRDIADRIEPPRLV
DNARELYDALLIAAAVEASMGSA
Download sequence
Identical sequences G4Z9G6
jgi|Physo1_1|131927|estExt_fgenesh1_pg.C_180036 XP_009525315.1.77131 67593.JGI131927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]