SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|132049|estExt_fgenesh1_pg.C_180158 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|132049|estExt_fgenesh1_pg.C_180158
Domain Number 1 Region: 75-192
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.8e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0022
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|132049|estExt_fgenesh1_pg.C_180158
Sequence length 205
Sequence
MLYILFVFAKLNPDIGYVQGMNEILAPIIYVCSSNPAIIWASEVEADAYHLFATVMASLQ
VLYARTPENPLSGADLQMARLAKLLRQHDAALWQHLNFVGLTPDLYSFQWYMTLLAREFS
MPDTLRVWDTLLADPKRFSFLHYVNCALVRSQRAFLLLHGFTTGLKKLQNLQSSDNNLNI
SEPLLSAEEMRRHDRNLDQAAAAKV
Download sequence
Identical sequences jgi|Physo1_1|132049|estExt_fgenesh1_pg.C_180158 67593.JGI132049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]