SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|133115|estExt_fgenesh1_pg.C_240084 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|133115|estExt_fgenesh1_pg.C_240084
Domain Number 1 Region: 174-298
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.8e-26
Family Multidomain sulfurtransferase (rhodanese) 0.0022
Further Details:      
 
Domain Number 2 Region: 29-159
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.64e-24
Family Multidomain sulfurtransferase (rhodanese) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|133115|estExt_fgenesh1_pg.C_240084
Sequence length 307
Sequence
MISSLRLVRSPLRRSAFSLRSTSAARSLSALVDAKWVRNAQESGDPELLLFDCNHPASYP
RGHLPDAVPLPLAASLLKDPTPQATGVVSAQLFAGVLQSLQVPAHATLVFYDDEMSLKAT
RMWWVFRHYGFPVEQLKVLDGGVKQWAAEDNEVEMGPPEDREVSTSTLWTQPVDTQKLVG
FNAVQNGIADASAQFVDTRSLGEYWGEDANGNARTGHVPGAFNFNWMEGVDFTQNGKFKS
KEELDKVFVDHFHLDKDKPVITYCQRGIRAAHTAFALEQVMGFKDVKIYEDSMLQYLNRD
DSVVEKQ
Download sequence
Identical sequences 67593.JGI133115 jgi|Physo1_1|133115|estExt_fgenesh1_pg.C_240084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]