SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|133686|estExt_fgenesh1_pg.C_270098 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|133686|estExt_fgenesh1_pg.C_270098
Domain Number 1 Region: 750-799,838-874
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000713
Family Cell cycle control phosphatase, catalytic domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|133686|estExt_fgenesh1_pg.C_270098
Sequence length 1340
Sequence
MSASDFDDIFGDDVKMDATAEPTLTNVNLDDDELFGGGTAGKVTKPASEQPAQGANWEQI
GSQEQDEFLSWLDDGGSSKPAPAAEPSLPEKPAPSVEVAAPPPAPVAPAPVVTNTFDSVS
LDDNDDFDRMLETGRTEPSPCVSTTTPAATVSCPNDNIATNDDDDLDRMLNASTAQATFE
MSNISKQATSQDESDDLDRMLASANAQANFDAPTPANTVGSISLDDDDDLEKIVQNAGKH
SGASVFVPAATAGNISLDDDDDDDLERIVQQANKQANASGSRENSSSSLQIKSQVQAQHK
AQQIVRQTFLETGELPAGSRLAAWQRAVQPGAADSASMYAVQTTSRSLPSQAQLRKEVET
LCSRIFSSAAHARVLSEVGDSMRGTHLLFIDSAETLLTHLCTQLDIDYMPGMAFTFAPLL
LASGSEPLHPETVETLAATCRRFLPHLGKKMPLHSSATGRRPLLKRMLLYHAPRLASHLH
EHFPTWNHAPPGEYDGTKGSGAIPDSWLASFFENEGMVSEPANFDFLLKLWDCSMMLEAF
SSNEDAPLATPCFITLYGIIKSENALLRMEGEQLRHCMVTTVAETLLRGEVTKSQVFVKG
IRRLMDATPPCFTTKLRRAGVPPPPVVETEAEKSADTAASAASTNGFGMNTLLSASTQGL
KDVSNLMIDMPVKLMIDMPVKLLTMVPLNPMAALSSPNSNSLTDSPETQQLFYLHVQAME
VAAVSATLECREVIPSVFGGITGHETGSLRYFIIDCRGVEEMRGGQVPTAFRFDPDAVSD
SAILDQVLATLGPLKSAGVHICVMGHGYAHIAEELRQFQQKQGVASASPFSLSEGFLETY
ANDQSRVQSTIDFLLKHEFPRVSVLEGGYSAAHGHLFRSHSLTVDDLADHDTPSCKLCQH
DRSMEAVHPAAIGDALNAPGAEEKKESMHEGDPANARTASSRTSEVPSGIAMDDSGFTDI
NLSPAAANTKSPPGGSYYSSFAGAFKSGSKTLLSPTVDGTKWLLKKSAATTAEFANAAAS
MGNLGNKNRTGSMQGAAAVGKTPAAPAKDTKPAMPNLNKLRNSLAAIGSESLDMLKKMEH
AVEQAAVATTTTTAKVRVPFPSTISPSSKDAAPAATKSPPPSVTGASTPPAPRASLSSDP
AHSKFFHQSTDEMFTIDDGDDDEDHEGHFVQDEASNSRTSSSTSSFVRDSPVAGGGVGPV
HEVVKDHIGDLKKGMTVSRMQTLPCVSSPFFACYKKKAPTGNSGAASHSSMHPRRIVVME
NHLVVLKSATRNEDDMFIVKSCHPLSHITRMTCLKKNALMVSIYYKWKADDGQIIERRNS
YEVQQRDDFIKAVKSTMDKM
Download sequence
Identical sequences 67593.JGI133686 jgi|Physo1_1|133686|estExt_fgenesh1_pg.C_270098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]