SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|134050|estExt_fgenesh1_pg.C_290117 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|134050|estExt_fgenesh1_pg.C_290117
Domain Number 1 Region: 73-203
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.73e-25
Family Cell cycle control phosphatase, catalytic domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|134050|estExt_fgenesh1_pg.C_290117
Sequence length 278
Sequence
MQLEGEPFEGVQIEAAGGPNREVQLKRAVSSQTMLTSSFSPAPVVPPRLLRHQASEQSIS
VMAASAPPPEPILPTVYSSRHPDLNVITPETVVRVLRGEYEGQLAGFQLLDCRFPFEFEG
GSLHGATSLCDPDAMEAKFFVSTELETYTRTALIFFCEFSANRAPKMLRHVRNVDRRVHA
DSYPELYYPELYLIDGGYKNCFETLPMELCASSAEYIRMEDERFADACRREFAAWRRRWK
PHKTVANCAANLEKGQRLHQGQDRSQLMHGVRSLFDAL
Download sequence
Identical sequences 67593.JGI134050 jgi|Physo1_1|134050|estExt_fgenesh1_pg.C_290117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]