SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|134607|estExt_fgenesh1_pg.C_320178 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|134607|estExt_fgenesh1_pg.C_320178
Domain Number 1 Region: 167-241
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000355
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 525-645
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000149
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|134607|estExt_fgenesh1_pg.C_320178
Domain Number - Region: 608-662
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000575
Family Ypt/Rab-GAP domain of gyp1p 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|134607|estExt_fgenesh1_pg.C_320178
Sequence length 664
Sequence
MTGTKGRGRGSVAARYARANALVGSVLNKFHNGSERAVDPFVIRTLKEHEPRLLGIRCFV
EQGPAEDSRRAKDESHVVNHTTHASGIFGLFTVCGGLFGPGVIMSVRVLWRELGGGGLST
WDACSGTEGDTDEREAAMAEYVATVDKMLPGWDESLPDHPVASTDRFWEDDATATNCPLC
FVAFSVRERRHHCRLCFSIFCAGCCGQILEVALCPGAPLRAQRVCTPCYQAEYRAQQLRE
ARKISRENQELEQRIRAVLSTAKQTLAAKQQEEQKLRALAIDAGCDVQALDEAIQKQHGG
SPIGSASMELPTPPAAHRFAPTQTSVEASNQLALAHRQLTMSFKMAQCRAHRVLDKMDAT
IAALRDAVNTQKSTNNRSPSPDHEDNGWSAMIRHTDSFLTQTDREALQVVSDELYSRLRS
RSSSSVDNSAASDQSIAMLWQTECLKDNRTRTFVTDLAEAVRARLDASSGSDTEDSDANE
APVATSRPLWEQPVQTTANASPASNSVPTSLELEKVYELICTQCETGPASEWDEQIRLDV
TRTFGISARRQHRKSIDPTSRAICHSNGVAIPLERRQAALQNVLRACASVDTEVGYCQGM
DHVAALMLAAIDFPISIVATGWFMTLFTNMEALSYDVVIQVFEGFIFKGWNHILRTALVI
LEEL
Download sequence
Identical sequences jgi|Physo1_1|134607|estExt_fgenesh1_pg.C_320178 67593.JGI134607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]