SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|135439|estExt_fgenesh1_pg.C_380073 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|135439|estExt_fgenesh1_pg.C_380073
Domain Number 1 Region: 283-457
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-24
Family Ypt/Rab-GAP domain of gyp1p 0.0078
Further Details:      
 
Domain Number 2 Region: 433-537
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-18
Family Ypt/Rab-GAP domain of gyp1p 0.0069
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|135439|estExt_fgenesh1_pg.C_380073
Domain Number - Region: 246-299
Classification Level Classification E-value
Superfamily F-box domain 0.00676
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|135439|estExt_fgenesh1_pg.C_380073
Sequence length 583
Sequence
METVSVAAAAVAASPVPVAPTPADLASPAASSPASSSGGEEPSEKLPPAAPVLKPLDPAS
APTATGNAHGLAGAFGMMKDRAATAKKTLGPQLLNMKDMTSKKLEKYQPTIVKAKTSATA
GLTTAASKMKEGSTQGWSMLKTKLAAAGPVAERIHTMGLNVMTDIYLGDTTVEALVCVED
PRSVSCFFLEKYKTSNVPVPAESPSKAAMGLLRMSRAISNSSTHSVENEAAPTTPASQCF
ATPYVLGTILLFCGDLPVLARVSCVNKACRDFIASERKLEKFCVRYGYLPPSIRFAYWEK
TTKFGKTREASEFDYDTYLQMALSKGDTTELIMTDVRRTYGRVAPHKRAANHKDEVSEED
LTTQLSEILHALAGRFPAVGYCQGMDYIAAHVLYKVKKSGSAADTKAEAESTFWLLVTLF
ERYGLHDMFAPGLHTLHVHCFQTQRLLELTEPALAEHFASEKMPIEMFAVGWFQTLYLYL
NVLPAEALDRIWDIFLFERNWKIMLRVAVALLQLSNEFVMDKPIDEIMQFFNTFADKADD
LLAEAPLTERALRLKVTNAVLTKLQKQHIKAKRASPTKTQTFS
Download sequence
Identical sequences G5ABC4
jgi|Physo1_1|135439|estExt_fgenesh1_pg.C_380073 XP_009536835.1.77131 67593.JGI135439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]