SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|135715|estExt_fgenesh1_pg.C_400052 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|135715|estExt_fgenesh1_pg.C_400052
Domain Number 1 Region: 45-329
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.89e-35
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 491-603
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000994
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|135715|estExt_fgenesh1_pg.C_400052
Sequence length 1316
Sequence
MVQTLELRATQDGVIWPRRPLVSSKGLLSRVQNLPLSSHDKSPARFRAVAFNASGELLAA
TDERGRVFVFFVTLNRYALVQHLGAPSVSCCFSPARKTELLVTCEDETVRCIDVQAQTLI
STLRGHRFPARCASFQRSGQLALTASQDAVILWDTKDWSRYRVLNAGPGVEEATFVARGD
LVAVCFQDDTIMMWELESLALRYRFSLPEREQSPGLQKIAVSDDQKVLVASGRAPFVYVW
EFESQTIIRIIELPPPIKHVVSHAFLPGHSTTISILGDDGSIFFLDVAAKNPQIKLEISN
NGRSISAFDIECHARYLAASTSDGFLLLYDMEIARETAARAQKRRRKEGLMDLGEHARIR
TRSGLPDTAFSDDDIGPVVEEPNPAELCQPDLSRPVPSKLIDSLFGAKVPKRAGRVTQQT
QQDTATTRQAESFHMRPATFGEVSYLPVVVYPFVKIFRENDLAAFEASVSVMLHWCGDFL
ISLPYPPVFAMSAIEKELARRDAQLFDHFTRYQVTSEAFAWSLLKTIFTEVLSEDEWMCL
WDHLFTYSDTPQLLFVAVLAYLSYFRTALLASCDRFSIEQFFHQQNAIDIQKFVQLMMNL
RSKLDLSEYTAIEESAATDASSQGRAPYWPLSRGQYPAFAHYPRFVVDFQISERNRIALE
EAELGHKQNLLDDIEDESRKLKAEHEKWMKERKLVLEAEERRRKEAIAAEKERILHLKTL
DYETRKRRLQHLSNMEASAHETLEEASKMLQTEYQRLESTLAMQKERMEFEISSRKQEED
LQRIESETHDRVRGIHKRREMEERLSRLRTEFETRVKQQELQDMLKFESWKREDEEQARK
AKILLRRREERALLSQEKRVRQELENKLLEQQLARDKELLELETARRTRRKQQQGHDELD
HEVNAQMDDSSAQEHANRLSTHVLDSKGRGSPRATEAFTCEAGSRATTSLQELDAASCKL
QRGDSSDSDKENTPASVHEQLIVDSDSDSEDDASLSVTDALQWPETARRARRKQQQGLDE
LDPPQSPLAFSQNEAVSAPQSTGELSPERHEFFMPEAPGSARGEDVSTLPATRGFSRDWD
GVTSTPPATREYSRHEELMFAPPAVRGHPNVQEEGFTSPATHGHPRAADESMSTPQVAQQ
VWLDHEVNAQMDASSAQEHANGPSAHVLDSEGRSSPGSPRASEAFTHKAGSQAATGKLQE
LDAVSRKQQRGDSSESGSVQKQVVMDSDSDSEDYSSSVMDALQRPIAELEKKLGIRFDDF
SDEEKEEDEYSFDIRQHSDEEEEDDETIEDDRAKLLQRAKRLLELSSFDTDSDDEL
Download sequence
Identical sequences 67593.JGI135715 jgi|Physo1_1|135715|estExt_fgenesh1_pg.C_400052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]