SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|136563|estExt_fgenesh1_pg.C_460109 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|136563|estExt_fgenesh1_pg.C_460109
Domain Number 1 Region: 102-228
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-20
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 208-319
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-17
Family Ypt/Rab-GAP domain of gyp1p 0.029
Further Details:      
 
Domain Number 3 Region: 388-500
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-16
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|136563|estExt_fgenesh1_pg.C_460109
Sequence length 628
Sequence
MVPKGPTDSVSSAETSTAAPKLQLSTRRRRHSNCDMHEAGGSSVAAPSVGVGVGCEKKRQ
LFWRNVVKQFNFTDQSERELLLSLTDGISWMHMRVLPRDFVRRHREIYYLISSPEYERSG
AIGRDVTRTFSIFERSHQHQLAAQQSALFRVLNAIAEAEDGYCQGMNFIAALFLVEGLSE
ADAYALFLYMLKKRHLAGIYHRSSTFLDEYLQHFEQMFIRDLPKLHAHLLAQGFAIPMYG
IEWFTTLFSLSTKTELACAIFDLFFVGVQDIFLRAGLAILKLLEAKLMCMAFEEFLREFK
PLVRELDPYQVILQALALRPNPKMHREDTTAHVSREHFLRTVGAVAPSCSDTGASSSDSS
SAEGEEESISSLGGFGLHRTLPPEMAEAVRSGNGSLVRRLWEAHVIRRHYSATASVVLAN
EILHYAIWYGRVSVACLAIDRCHADVDNRDDAGLTPLHFSVIRNQPDMVRLLLAHGARMQ
ETSMRRYSPLELAHRWKRRDTTAARLVLEKEEVCLYCNTKFDVLALETAVCGHCEFRFCC
RPQHALCIFKHQCPKANCAGGGRVRGFGRDRRLSEPTMAMLNICDEAADSNNDKEAGFKH
VNGYNSVDVQSGWGQSDAESQRIRVFVA
Download sequence
Identical sequences jgi|Physo1_1|136563|estExt_fgenesh1_pg.C_460109 67593.JGI136563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]