SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|137239|estExt_fgenesh1_pg.C_520029 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|137239|estExt_fgenesh1_pg.C_520029
Domain Number 1 Region: 164-287
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.02e-19
Family Single-domain sulfurtransferase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|137239|estExt_fgenesh1_pg.C_520029
Sequence length 439
Sequence
MRTLRAPVRLVPGLRRSPLLQWSLQRLPVAVTHQDSLAGRRLSSAVRAAGISRRQYISLY
NYTPLDKKKLPKLRRDLREQWGDLGVVGRIYIAEEGINGQLVVPEPAVKAFERSFPRLLS
DAKLFYGQLIEDKARSEGGLKAAEPFHKLDVRIRDMILHDGFQGGALNLKDSGDSLPPDQ
WHDKLKTRNETQDSDTLVLDVRNFYEHEIGRFDGATRIMVDTFRDTFDALDEILEKHEQQ
HDGQKPKQVMMYCTGGIRCEKVGAYLTQYKGISNVHKLHGGIVNYMRFLKEQRQAAAEAR
ARSAAADDVAEEDEKEISLFKGKNFVFDQRCVGELTESEEVTDDVLGKCFQCGEPCNHHT
NCSNLMCHGLILQCSKCATSMLGACSEACKQEYVKMESMDPDEQRSYRKANALTWKPKNP
NSVKYIKFRPPSPELLQTA
Download sequence
Identical sequences G4YH01
67593.JGI137239 XP_009514977.1.77131 jgi|Physo1_1|137239|estExt_fgenesh1_pg.C_520029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]