SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|137488|estExt_fgenesh1_pg.C_540074 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|137488|estExt_fgenesh1_pg.C_540074
Domain Number 1 Region: 170-318
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-35
Family Dual specificity phosphatase-like 0.00041
Further Details:      
 
Domain Number 2 Region: 33-151
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000624
Family Cell cycle control phosphatase, catalytic domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|137488|estExt_fgenesh1_pg.C_540074
Sequence length 366
Sequence
MGETQLVQVVPARDACKCAATGAVCKKRALRKRVVDSRWLFNNIHVGEIIVDCRSREQFI
SNTVVGAINVPPPPEDDDTSDCAEYVENQGLSAFKRGLRDILLFADAEDLSNPQSWFFRL
EQFLIDDGRAATIKGLCEGFSKFHKRYPFYTTQGIVGDGVLQSGKHQVSFPNEIIDNLLF
LGNMWQAQCQQVVQHLGITHVVNATLDIGNVFEQDGIKYFNVKLPDKPEANVARFFDAAF
EFIAKAERSTTKDGKPCRVLVHCTQGISRSATLVILYVMRAYHWSLAQAFNFTRSGRGVV
VPNEGFLRALMREERRLFHGKCSVTEDELDLLVSGGLPSRPARLERRTSPQLELPAVSKE
GQCSIM
Download sequence
Identical sequences G4Z958
67593.JGI137488 jgi|Physo1_1|137488|estExt_fgenesh1_pg.C_540074 XP_009523829.1.77131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]