SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|137489|estExt_fgenesh1_pg.C_540075 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|137489|estExt_fgenesh1_pg.C_540075
Domain Number 1 Region: 239-386
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-35
Family Dual specificity phosphatase-like 0.00029
Further Details:      
 
Domain Number 2 Region: 406-481
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000125
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0079
Further Details:      
 
Domain Number 3 Region: 83-217
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000686
Family Cell cycle control phosphatase, catalytic domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|137489|estExt_fgenesh1_pg.C_540075
Sequence length 771
Sequence
MPAAPAHSLAGHNPTPTPTPATLVPQLPTAAMSVGDDSASSSKNAASDVAKDEAPDAAGA
CPTEDSSEPVASSPPPRKRLVRTGEVNCRWLYNQVQASRGMILIDTRTREEYEEDSIPSA
ISVPPMQGCRSLDDVEGGLLEEQRYLFSSKKRKLRDVVLFGDAVKKSSADDAGVAKNPCS
WLRKLERLLIEDGLVTSVKLLTDGFLTFKYRYPFYTTSALLDEISGQLTRTKSGTHNLNY
PNEILEGFLFLGNMWHAQSKQVVSHLGITHVVNASLDVGNTFESDGVKYLNVTIKDRPEA
DISSYFDAAYRFIESAKRTQHGRVLVHCTQGISRSATLVIMYLMRANNWSLVTAVNFAMA
SRGVVYPNQGFIKSLMVEEFRLYKGNSITSDEVDNMLQNLIPDRPVPLQVHSNKTENCSR
CRKMFSLLEWKHKCSYCRKAFCSKCTSTRLANPEREKTAASKGEVDEQRPRRVCQVCVSR
LWQINLPRSRKGLQPRVQRCKHLNVNSLSTFGRTVCISYFEGTEAQVIMDVLKIRFGVKE
NQIIDISREDGEPIRTVEEIAELPDEAEVFVSVGKAGNIQEYSQRGTKPQQPPANSRYAN
SNHRQPYTRHQQQERTRQQCRRDLQSPRERIFRERSSSEGIVDTLQQIETYGRHPDAPRT
RSFQMDNTNVETPATTPPVVEDPEVAERKFRELWKLSFPSMGLIERGALLKIKRPEILMD
VMLGMSSLSCGALTLQEFSQRLIELGYADSDRQAVIALLDTARRATGRVVG
Download sequence
Identical sequences jgi|Physo1_1|137489|estExt_fgenesh1_pg.C_540075 67593.JGI137489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]