SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|138467|estExt_fgenesh1_pg.C_630086 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|138467|estExt_fgenesh1_pg.C_630086
Domain Number 1 Region: 98-246
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.88e-25
Family Single-domain sulfurtransferase 0.052
Further Details:      
 
Domain Number 2 Region: 795-900
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000243
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 3 Region: 976-1178,1236-1273
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000144
Family Armadillo repeat 0.06
Further Details:      
 
Domain Number 4 Region: 665-775
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000021
Family Prokaryotic proteases 0.008
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|138467|estExt_fgenesh1_pg.C_630086
Domain Number - Region: 425-457
Classification Level Classification E-value
Superfamily WW domain 0.000118
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|138467|estExt_fgenesh1_pg.C_630086
Sequence length 1371
Sequence
MGQDGGAYAVVLYYKYVRLCETQQELDAFAAAHEALCSSLGLTGRVRLAFEGINGTLGGS
SASVQSYIEAMKQRPQFADVDWKTSASSVEPFPELQVRVVAEIVALELPDDAYDLALRGQ
HLTPEQFRSAQLDADPESIALIDVRNTYEYQVGHFAGALNPKTRRFGQFPQWVRDGLPML
QQKSKVLMYCTGGIRCEKASAYLKHLGLDNVYQLEGGIHRYLERFPDGGGLFQGKNFVFD
QRVTMASEDKSVTGQCERCQVLHDTLSGTRCAYCRMHVLLCDGCRADAKARGETDDDVFC
DEHLPLVSGSLEDLRTRVQSLQDSLDNEHGRGKKGRRRSLRKQLDTVERRIQRLVSMRGA
GRRGGGGGGGRAGGHARRKTGADSSSDPKTSLVDEWRAHEEDCAARVLQNQLRAYLSRQR
IARLLMSVYEKHYDPIRKQHFYVNTLTNVSTWEKPLLLVRFLPGDHNISRGRVELAPKEA
SQRIQRVVRAFLAKKTIRQLVRENYMKLFDQESRVFYYLNTRTGERSEQKPPFFRQRPNT
AGAISKRATSSKNDDDDLEIEPFYFRKAVCKISSEGNPYGSGVIGRFCGILCVLADGKTL
ADENCARSARVICNYADERVAFPVMLSADTFFAGIKMPEDSASRLQALDGVTQPHPQSPK
KKNRKPQFDFALCALNEDQFLIAAGSNIQPLRFEVNDRKLGCGEAESLRLGDHLEVVGHP
HGKLQVLHQRQLAKLVPNSINPQHLQYDSVMESGSAGCAVFTRGGKLIGIHEFAGPKEPP
PLLCWYIKPILHTALTLVTPPEPLILTSCVASTGVQVYWQLPRDWQALRGLPVDFELEIC
RHGTLDTLHHDPFERIYSGPKSSHHIDDLHGGTMHSLRCRAVNRMKKSRWSSVVRFITLQ
QVSLAWRLRHCTTVKEAIKRMKHQRADPQTQFRSVQWIYAQLEKREEADRVEWEHQTDGM
RGDRGKPGVSNQVEFEQELLDCQGLEALLDSIAWFPGEKDTIALIVRLFLKLACLQKSTQ
RFMTETSRFQVLCDLLRSHTTSSDAPQDVAEDTCTEELKASGPELEIPLLCLELLGTVLS
ENGAAKLVFESCSGVGLVLSFLERGAYRNEAAVVGECCYILAVFSYENASVKWEIAEANG
LALLQRVLLDHRQASRVLYWALITIGNVAYGLDESTTRPQLEAEITTLGLVDSVCAARVH
FLSRLHELELSLVAAQARLDRLYAIHVGEETRNELDACTQLVETLKNVIADWQSYDVAKA
ADYALRYLLTEEQRRVQLASKRLMWKFLLRTLSMAIEKWCEVTVYERHRAMFVTFINTVR
TRQLRPAFRRWEQTTREMRKHKSILQTIGSGLAIDLTKKKRERYRMLVLQK
Download sequence
Identical sequences jgi|Physo1_1|138467|estExt_fgenesh1_pg.C_630086 67593.JGI138467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]