SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|138769|estExt_fgenesh1_pg.C_660088 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|138769|estExt_fgenesh1_pg.C_660088
Domain Number 1 Region: 125-246
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.43e-29
Family Single-domain sulfurtransferase 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|138769|estExt_fgenesh1_pg.C_660088
Domain Number - Region: 253-293
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0096
Family Rubredoxin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|138769|estExt_fgenesh1_pg.C_660088
Sequence length 294
Sequence
MATTESAKAAYVNTSAYGFCVFTAERLPELRQQLLQVAAQFGEEKLRGTILLSSEGVNVR
LSGTSDAVEAMKAAIAALHSDIRGLEFKDSYSERMTLPRMLVKIKKEVISMGMEQVNPAV
DGLAAHISAEEFKTWMDDGKDMIVLDTRNDYEVRLGTFENAVYLDIKSFRAFPNEARTQL
QQVPKEKPIVMFCTGGVRCEKASYALLNEGHKEVYQLDGGILKYFEKVGGAHYKGDCYIF
DDRVALKPDLTEAAVTSCFVCRSPLTEEDRSSPDYDPEKHCPYCKNGKQDFRHV
Download sequence
Identical sequences G4YXY5
XP_009520976.1.77131 67593.JGI138769 jgi|Physo1_1|138769|estExt_fgenesh1_pg.C_660088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]