SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|140213|estExt_fgenesh1_pg.C_830020 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|140213|estExt_fgenesh1_pg.C_830020
Domain Number 1 Region: 93-215
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000628
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 
Domain Number 2 Region: 483-516
Classification Level Classification E-value
Superfamily WW domain 0.0000668
Family WW domain 0.0042
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|140213|estExt_fgenesh1_pg.C_830020
Domain Number - Region: 557-675
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000127
Family Single-domain sulfurtransferase 0.071
Further Details:      
 
Domain Number - Region: 284-375
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000759
Family Ypt/Rab-GAP domain of gyp1p 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|140213|estExt_fgenesh1_pg.C_830020
Sequence length 923
Sequence
MASPSAAARKQQEALRRVLTRQSLRLWASKAAQERAHLAESLLQLFSSGQASSGAAVAPA
DLAARPITRRPGVEEVKGCVLSSVYPCLPPQCDALRGEIWQVLLNVYKRNQHGSAAQEFD
RMLQRLGKLPRDPLLVDECGDVAEILEPADAKARERVQQELEVLLMWFLTTKSVAYSTGM
ARVVAPFFLLKMPLPTIYDCFYQYCAHFLPHFVVADSLFADAPGLGAVGGGLGSNRGSSS
SMDEAYAGSSGLQRSSSMDSTSSLAEESKRRADEEEAQALRRERQQLVEQLLSYHAPQLA
HCLNQWCGNEWSVAGKLFAADFLLGHLYQVVPPAAFVFVMDQYLLTGDSLFGLFFVIAAL
IQREEELTSCDSTEKVQDQVRSTFAAKAFEDEENVRYLCLLASRLRSKTPKTYKCSQREA
TADIRCSSRQAIEIAYGSGAGMAAKKARAQSNNGSLSGPPSSSNSLSGPPSSDRKSTAEA
AVDMSQWVMKESRSIAGKIFWYHTQTGKTQWEHPAEKHDPPSAYFALPISVEEVGPQLMG
GGDKSSDQQQTGMSNLRFFVVDCRGLRSSEDLKSGRIPVAYTLDPSVFDSPELIAKSMEA
FNPMKSQVHVVLVGHGVGIPPELVTSEDVKTSIRDAVRLDTDCLNQAALFFQKRGFRFVS
TLDGGYSSWHAFMRDRAGSSPQELLNHVADECVYCRYDTILRTGEDPLKQKSKQKKPRRK
KAMPTMTSLPVNGGEGDASIVSTSELNRASSTSIGSNTSGPTTGRRQLSLSRSSITSMRS
KLSEVSIPKKWGWRRRSSTNASQQNDSGSSSEAASAEDGGSDHGSSNEELEEKHDEATHE
MLRAALEEPEDVTADADGADATKDSKFVGVFTIDYSDDEDEDNNEELTTDSGDTESVSKS
VEHETVPAVGAVVGSDADPTASA
Download sequence
Identical sequences G4Z2Q7
XP_009524899.1.77131 jgi|Physo1_1|140213|estExt_fgenesh1_pg.C_830020 67593.JGI140213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]