SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|141726|estExt_fgenesh1_pg.C_1020049 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|141726|estExt_fgenesh1_pg.C_1020049
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 7.07e-20
Family Cell cycle control phosphatase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|141726|estExt_fgenesh1_pg.C_1020049
Sequence length 137
Sequence
MPTPEELLAVERISAEDLAAALRSDAEHPVVVDVRNEDYELLGHIVDAEHLPSATFKEDA
DVDALVAKFGSKQNIVFHCGHSNTRGPTCALRFIERAEAAGVKTHVRVLAGGFADFAEKF
SGSTDLVTPPSKPTDAE
Download sequence
Identical sequences G4ZS19
XP_009531627.1.77131 jgi|Physo1_1|141726|estExt_fgenesh1_pg.C_1020049 67593.JGI141726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]