SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|143815|estExt_fgenesh1_pg.C_1520022 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|143815|estExt_fgenesh1_pg.C_1520022
Domain Number 1 Region: 159-298
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-30
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|143815|estExt_fgenesh1_pg.C_1520022
Sequence length 299
Sequence
MARAKTTTLDGSTMGGAGHAAPPAAARAHGRHLACFRPKRRFRLAKAASLQEPLEDVAAG
RLDLACHCERQVLQCLADAQDQSDAALATAEDLYRYRLRKWGERFAARDWAQERVCQKWK
ENQKRFTQQAPDDASNTKKAPAGKSVKMAFSTFATAAELMLHSRQFDALLKAGVSPQLRG
QVWWMCSGAAELRRAAKESYPALLHRLHTLSKCAEMDIEKDLPRTFPLSLRSSMRQSQEL
SEDGDHFGELRRVLQAYSLRNPTVGYCQSMNFLAAVLLQQMGEEEAFWVLASIVEELTP
Download sequence
Identical sequences jgi|Physo1_1|143815|estExt_fgenesh1_pg.C_1520022 67593.JGI143815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]