SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|144222|estExt_fgenesh1_pg.C_1730012 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|144222|estExt_fgenesh1_pg.C_1730012
Domain Number 1 Region: 17-155
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.44e-32
Family Multidomain sulfurtransferase (rhodanese) 0.00021
Further Details:      
 
Domain Number 2 Region: 174-301
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.36e-28
Family Multidomain sulfurtransferase (rhodanese) 0.00022
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|144222|estExt_fgenesh1_pg.C_1730012
Domain Number - Region: 320-406
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000502
Family Centromere-binding 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|144222|estExt_fgenesh1_pg.C_1730012
Sequence length 463
Sequence
MSGSPRASSSRLASSLSPLLSTEQAQTLAQGGERRVRFLDASWYLDKSRDAKKEFAAERL
PGAQFFDIEQISDGTSTLPHMLPTPETYEHAMRYLGVENDDTVIVYGGKHCFSPARCWWT
FKYFGHDSVHILNGGITKWKSEKREIETGEPQTVVAGAAYKAKPNEDLAVSWEDVLAKIG
SDTQIVDARGAARFYAKEPEPRPGMRGGHIPGSLNVPFGKLVSPDDYSLFRDLADIKAAF
AEANVKTDETSPIITSCGSGVTASVLTFGLHLAGKPLDKAPVYDGSWSEWGLRSDLPLEK
ESKIYLEQCGFSAEQTQITGRDWVLVADCNGIPPTTARNIVQRQAADVKKRGDARAACTK
CTPEMEEALVGYLEDNCQYTLVQMQEMLAFDFRVHISTSLISKKLCDKLYTVKQVRVEPE
TCNNAVNIEKRRVFGEALLKHERNGAFIVYYDETNYYCTTCTY
Download sequence
Identical sequences 67593.JGI144222 jgi|Physo1_1|144222|estExt_fgenesh1_pg.C_1730012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]