SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|155434|C_scaffold_4000002 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|155434|C_scaffold_4000002
Domain Number 1 Region: 240-364
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0077
Further Details:      
 
Domain Number 2 Region: 23-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-19
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 393-453
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000863
Family Ypt/Rab-GAP domain of gyp1p 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|155434|C_scaffold_4000002
Sequence length 796
Sequence
MEDEPLATGVMLSPTRNVSQDGEIVRRWMEMVLGDKFLDDLPAALRSGELLCDLVNKLYK
ALGMKSQISPVRAAATSEQDALGNVCEYLRACEVLGVARQDLFQPDDLLKRKDMEKVYSN
ILALQTVAVSLSNRRSIDERSSMINAPDWSPLSEHGIFTEDDVDIDADDLDLDSPEAVHM
LQQSRWQRLLFEYEHQQQRKEENDLAGDSSASDGLGPLAHGIWRTEERIRAILMRDDRDF
GAVPEELHGKLWMLASGAQMEMRKHKGMYERLLASELESTEATRQIDVDLHRTVAEEDKE
LWTDEKSKIMRRVLVAYSYYNPGLGYCQGLNYIVARSLQHLSEEEAFYLLIAIVRLVPDD
YYTTMISEHLTELGGSGMELSLACTECPCERGVTFQIWDAIFLQGEEVLFRVALALLQQA
KAELLACNAYGDMLKHLNELGRGNVDALELMKISKKQDWIVASTVETEDARSSTTGRRSS
ETRSEPRLRIFGRKNKQGIFRHMDKIPPRLARHLTDEYTESIRRDHPHFAGYYEGIQLQV
MEEYWGSADSYRQWGVRNDNEEIGRSPLAWIQRFEEWHKDMKTQKEKKKAEKKRFRLYQR
SEIHVRSNSVDFIVDEPSSRVPRQAHSRSNSVDYVVDKPARPPVHCRSSSVDFAVDESSA
CAVPTIRRIVSVPIEDQFAQRLRNKERANVLQYMHRKASDASSIAGSIPRSPARMSESSS
DSSRFGDHASNRSGKYRKSSFSFFDKLSSDLEGSLVDEAEFKTESIGRGSLSSVATGRSS
TVDEQRPMGGPISISS
Download sequence
Identical sequences 67593.JGI155434 jgi|Physo1_1|155434|C_scaffold_4000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]