SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|156743|C_scaffold_26000027 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|156743|C_scaffold_26000027
Domain Number 1 Region: 128-238
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000000133
Family Single-domain sulfurtransferase 0.03
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|156743|C_scaffold_26000027
Domain Number - Region: 245-297
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0259
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|156743|C_scaffold_26000027
Sequence length 349
Sequence
MVTTDSEPVGHAVILFYKYVEVAAPLELKQEQEQLCERLGLVGRILISEEGINATLSSSS
RAKIDEYIAFLCAHEVFAMRAEDFKHSFHAHENPPFVGLIVKHVKEIVSTGGVVARPDMA
ASDEERGYLTPQQFHEAMRQAVKDKEGTVVLDDAVDPKVKNFSEYYTFLQNRVDEMKDKK
VLMYCTGGIRCEKASNFLRSQGVNDVHHLKGGIHKYLEAYQDGGFFRGKNFVFDKRVLMG
AQNSNEVVGKCIECQTPHDEFSGRKVCTVCRDLVLVCDSCYYARHGEVHCTDHQYLKDCY
VTFLQYLPRADLLEHQKALEKILAGLLEDKNSSKNKRRSIRNQLNKIAA
Download sequence
Identical sequences jgi|Physo1_1|156743|C_scaffold_26000027 67593.JGI156743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]