SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|157362|C_scaffold_43000007 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|157362|C_scaffold_43000007
Domain Number 1 Region: 468-595,636-792
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.76e-58
Family Regulator of chromosome condensation RCC1 0.0059
Further Details:      
 
Domain Number 2 Region: 911-1103
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0028
Further Details:      
 
Domain Number 3 Region: 1087-1179
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000204
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 4 Region: 25-104
Classification Level Classification E-value
Superfamily PX domain 0.0000000314
Family PX domain 0.0051
Further Details:      
 
Domain Number 5 Region: 196-361
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000146
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|157362|C_scaffold_43000007
Sequence length 1271
Sequence
MAGGGFGFGLLTDVQMVGFYQARHRSAGGKPFLAYVLQVATSSAHFLVYRRYSQVAALAA
KLHFHPPVGLPPKYALQVFPLSDAQLQQRFDGLRAFLRAVVDHLARQHAAGMHHDAQSSA
GLDMQIFCDFVAHHRNRPPRPARGELPDWARPETAANWADADSVTDSEDVGLLESDGDDV
EDHGEQAGDASARFRNEVLQAEGNLSALWYCVRAYMQATTAWWGATQAVLDEYKRVADMS
LRKSEDDGRTHAARLVKALAQMLEAVQPEFDKKCEDAVLTPLEQLSRDVLPEVKHTYWTR
HNNSMGEDTAREVNVRRLQQERETLHAKLRADVQSSMTALVALQNEMLAAMHDQLHGFER
VERMPRQRSQSQPVLNRRNSRRGRGSISFAVSRAAQSLPHEESSAATGVDDVDDVVEADR
SDQSEEGDDGNESDDEEGTAEDDAEVEDEDERELDHLNDHQSEEPSSHMWVWGRPPSLEG
GTPLVLRPKQVSLLNGQPIVQVACGGEHLLYLTSTGDVYSYGDNEDKKAAAVTIATNANS
ADNDYTRSISKELALEKALHRTTIAMISCGAQHSLAITDAGELYTWGSGEDGRLGHGDMR
DRAVPRKVMSLLRESVASASCGLGDNKWRDTPHQIVGFPQGTRISNVVCGWNFTAALDRQ
GNIFTWGKTGEGQCGLGYVDKDQVVPRCVEKLREVAAGSAAVDVACGYTHTVVLTASGEL
YSWGLGEYGQLARVQLPSDALCAPDQLTRVYCGAFHSIATTEKRVMFAWGLNSYGACGLG
HTANKDKPERIDCFSSQTELVVACGHKYTIALEVDPALYGHSSSSSHAMVRTGAAVDGLA
IPRTQRQVSEGSEASEDDPFFGRGSPGRPTTPTVGTRRHRRGSPPTLAMDLGEAPREAIH
EKEEELRRAKKLWRTRILRDWEENKDTPLAHSLWRQGIPPSIRARVWPMAIGNKLKVTPE
MFKIYRRRAAAYKKDRAAKEKNDDVDGGREHTLALIDTDLPRTFPSLKLFDSSGPYYAFL
LEVLETYACYRPDLGYIQGMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDAD
LANVYYTLFDTFLNSRLPHLHAHLREIGVFSCSMYLMNWLQTLFLQVLPLESAARVFDNF
LLDGTVFLFRTAMAIHELLAPQLLAAEIDVALPLLQRNVIYQDEWNARVSEQSLFDTVAT
IAVPSHIYSALDRVVNDVFFYEKRGDPDSIGGKKMMAFASGGQSVGIGHVKHERRRMYAI
SDALNGVLGGF
Download sequence
Identical sequences G4Z106
67593.JGI157362 XP_009518719.1.77131 jgi|Physo1_1|157362|C_scaffold_43000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]