SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|158326|C_scaffold_96000007 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|158326|C_scaffold_96000007
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000288
Family Ypt/Rab-GAP domain of gyp1p 0.0083
Further Details:      
 
Weak hits

Sequence:  jgi|Physo1_1|158326|C_scaffold_96000007
Domain Number - Region: 242-340
Classification Level Classification E-value
Superfamily EF-hand 0.00192
Family Calmodulin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|158326|C_scaffold_96000007
Sequence length 343
Sequence
MPADWFATSGARELRDNSALDYREYVRRSEQCASPQFEEDLRQIELDLPRTGESMRLFLL
RPEEREALDEDEELPPQRNPRVGYVQGHADVLCFLLGNVNEKRDEEETFWVYASVVERVF
PDDFFARTPKLHGFQVDCKLYHELVVRKLVPHYPILAKADLPLVATLLSCKWFVSLWVGE
LPLPLLYEEMEQWDSSYIYKIIMNQCQTATEISPHELLQQARTLYGFKDESVEDMRAAIR
RLPQLRKAEFAVLAKQTHFSHLEMERLQDEFTFLRFQRKICGRSKLRGLRQEELEGILSR
EFSTFLSAASRGAPEEKAQLLFQIPDHHDHQYLNQQGIEQLAG
Download sequence
Identical sequences jgi|Physo1_1|158326|C_scaffold_96000007 67593.JGI158326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]