SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|129456|estExt_fgenesh1_pg.C_70281 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|129456|estExt_fgenesh1_pg.C_70281
Domain Number 1 Region: 132-179
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000665
Family Ovomucoid domain III-like 0.0049
Further Details:      
 
Domain Number 2 Region: 196-235
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000236
Family Ovomucoid domain III-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|129456|estExt_fgenesh1_pg.C_70281
Sequence length 670
Sequence
MKLAIGIVLAAIAVASMSAGDPATLSSKTPVEEATKTTEATKSSKSTKTSETSGSGIGSL
FDDASGGVIGDESGADAKTVDPKFLTSIGITVPMSEAGSKFDLGLGPGPAVYPSDSGSWD
WSWDSVEGSGSHHYDCDTVCPGDYEPVCGSDNVTYKNECAFTVAQCNATDLAVASSGECA
LASSKASTAGSSTGESCPDACTMEYSPVVDENGKEYSNECAMRLAKCKGETGEKKKIVDF
TALDKPSLVKGVKETEAPSTATKSSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESE
SGSADPTLVKGVKETEAPSTATKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGS
ADPTLVKGVKETEAPSTATKSSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGS
ADPTLVKGVKETEAPSTATKSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGSA
DKPTLVKGVKETEAPSTATKSSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGS
ADPTLVKGVKETEAPSTATKSSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGS
ADPTLVKGVKETEAPSTATKSSKSTKASKSEKTGTASGSGIGSLFEDGSDGIIGESESGS
ADPTLIRWRA
Download sequence
Identical sequences 67593.JGI129456 jgi|Physo1_1|129456|estExt_fgenesh1_pg.C_70281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]