SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|134696|estExt_fgenesh1_pg.C_330086 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|134696|estExt_fgenesh1_pg.C_330086
Domain Number 1 Region: 271-394
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000873
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 2 Region: 655-741
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000288
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Domain Number 3 Region: 1-41,80-172
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000212
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 4 Region: 510-632
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000732
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|134696|estExt_fgenesh1_pg.C_330086
Sequence length 862
Sequence
MEGVLWTREGRSKLLRGWHKRYFVLSECGTLREYASDVSKKELLQSRSRRASSGASTTSS
TSSPERSRSISSLNSSGMMLRRELDVRGAAVKTLPFPLVGRHNAFQVTITARPVSSQSGA
GEAADDAATSATKLVLSARQADDVRQWMGAIRSAALKLSIPRRPLSPMGWSRGSDSRASE
GNLESDFLDVRMPQRADMALLSSVYEWIHECCVKTSQNLTVAGVHVPRGSLLVSANGVSL
QTLTSVEVRKLLLESTGPLPVSLRFLRSPAKCGVLRAKLYTSPLTQLKSLARYRKSSRMD
WKEQVVDLSGDLLTCQLKMKTPVAIGNSKKSSSSGSKTKRVLLLSSGSCVKPVHELVSDR
KFCFIVTVQSHSMLFQARSEADRRAWTDAIQRAITIAEGLVPGGALARGSFDLDALQLQS
SMNMRHLDQAFEGMEEGNGAVDFDDDSDLSDEDVEEELSPMDPTPSFPSDKDWASATQSG
AYLPDRELSEMLRVLQSSGRFIEALQLMQKNTTLRSKYWRQIFRWALIPARSDEENKKLF
QQLINTSLAEEDDLQVQKDIPRTAKWLAGSAGAPKLDEISPSSTSSPPSSPSFYMQGMNG
LAFILLEVLENDEVEAFRFLRGIVARILPHVFGICCEGTGRDHFDLFRSLVEVGDVLQEV
ARLHLPNFHAALDSAGLPVCLLAYKWFPTLFSDVTLTASHSQLRFDTLLCCWDVCLLLGL
EGMFCVALALCSAAEDDVLALAACGEAVSHSAEQVSATVGRALALLSPEDLVTSVCEVLE
LCSHPVLLKLRNAHRRRLKLGYSKVGNGFAASGTRSSPDRTVAKTPSTSTPAPPMTVTDL
DSGKVFKISTSGNMLLPTAAPQ
Download sequence
Identical sequences jgi|Physo1_1|134696|estExt_fgenesh1_pg.C_330086 67593.JGI134696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]