SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|137454|estExt_fgenesh1_pg.C_540040 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|137454|estExt_fgenesh1_pg.C_540040
Domain Number 1 Region: 84-244
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-24
Family Ypt/Rab-GAP domain of gyp1p 0.0078
Further Details:      
 
Domain Number 2 Region: 223-334
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-21
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 914-1027,1238-1336
Classification Level Classification E-value
Superfamily Fibronectin type III 8.16e-19
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 814-894
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000171
Family PDZ domain 0.039
Further Details:      
 
Domain Number 5 Region: 432-481,568-615
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000915
Family Cell cycle control phosphatase, catalytic domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|137454|estExt_fgenesh1_pg.C_540040
Sequence length 1590
Sequence
MDAFCASAAHAPPHTASQDASPPNDASAASELPVEAAQSPCQKPTQNPMATSTPEATRSA
LEEQLQREMLKRRPDHFVLGVTCRALGGVPAQLRARVWKELLGVARSEQQRLCLDRSILK
VEEDLDNQRVIAADAARTRGNEPRFQQPETVELVVKLLTYYCKCRSIRYKQGMNEVLAPF
LLLTERRDGSDEPVPLAEGVVFQCFYALIDKFLPHVFVDKEFRSLQCSFQLYKLLMLYHD
PELCHYLDQHDMTPELYVTPWFMTLFARSLPPEFVFYLWDFFLLEEDPYLLHFVAYALVA
NNRERIFEAEIPMLPQVLSSLTFSTREELEQVCASALAIYESTPRSFKRDLYSVCYGGFT
DAMIPFFEQLYACSSLQVYPEELVRNLLDRLATKAKQKCMPEPVLAPAAPVLQEECLYAP
GTDDGEESTALKFIVLDCRPAEEYHKSHLSLSHHIDPSIMSRPDALDGLMKGFSHMKGCH
FCFVGPSVDSPSILPRTSSNNGILNPIARLARVISSDKSQHAPAPDPIQISIDVGVAGEV
AGETSPSSSASTGPVTLSRKQSPGEPGALASEIGSSGASKVHAEHESVTRLVLMFLQKGF
KFVSRLDGGFDALEKNIRSMDAFAQEQLLVSSPLPLPTTEQVPTAPDSNGSTSSGGFNLL
AKIGLNRSRAPSHDDFVAEAPSSTRTETSETSSTRSTTTTTTTTVTPISSAPSSSTSNEI
KEIKEVKEVKEVKKTKTKLTTSSAVSTFSQRLSFLKAAAKDVVTSTSSSIARTSSNASVE
TKDAAEEKSGSNEDGWVEVRVNTDEVAEKSSGTTIDVEIQPGPIGILFQKSRTSKKYQAV
VDSVVPDSQASATGLINAGDLLVAINGESLEDVAFLSVIELVIEASRPVVLRFLTPVSKD
KDKEGNASDAISIPPLAPTLVSATRHSVCITWDKLPASVAPPSMARYQLQFAKQSGDEFN
PWLFAAMKQEGTTAEMNSTGITDQTNGTMLGLDPGESLVFRVRCGDGQRWGPYSLSSSSM
KTLDDRTAGPLVPMSGTVTPKGVSRDELTSAIFLPGVCPEYVERGQFFYRVLIALRARRR
PDFNAEKLGIVLDKGMVIRGSERLVCPGTNQIFVRLEFGGSDEAVEDGREYEGNAGELVL
LRNGQREADADADGVWAFENTPDGDVVLERLPQSEVEEIGPSLQEQAKSLVQSFLSSHGI
TTPPSTTDSGSLEDNANSNSAASISSMVSTAPSSSSGISAALSSHAPVAPRILQVFPASS
SEVIVTWDPVNDIGVTKYQIQYVKDRLAAMWWTLKPDIDADTLKYTVTGLQANTSYLFRI
RSGTEDNKWSPYSESSESCRTLATGKVLVNSSSSDDDGDPSASRPESSSGSKRSSVSVPT
SAPQVSSMRTGSTILDKAVALTSRLRRRSHSTNNPQVEAQPDEAPVDTKDEGESQQHEED
KICELELPSSRQVNLASWKSSSSEAHKSFRFYRATKFEEQDEDSHKQLTRLGERELVVTP
SLLVVLNVMAATREGFALVEEWRPLTSLIKVAERDDLDNSLVFHFNEDATTPDSTDDTPH
SDQLIVKVDGAKVCAQVVQEYHANTSSLEE
Download sequence
Identical sequences jgi|Physo1_1|137454|estExt_fgenesh1_pg.C_540040 67593.JGI137454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]