SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|140963|estExt_fgenesh1_pg.C_920026 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|140963|estExt_fgenesh1_pg.C_920026
Domain Number 1 Region: 326-462
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.18e-20
Family Nuclease 0.029
Further Details:      
 
Domain Number 2 Region: 57-266
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000173
Family Nuclease 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|140963|estExt_fgenesh1_pg.C_920026
Sequence length 549
Sequence
MVNVHTSARLVLAFISLAFQVSSSLSASSAVQQPLLDATDWFLTEQEITESRGGILRRDM
AVYTTGNAITPFTVANEFYNAVYDDLTGTKEGDRVLLSAYVTALVPLKPDVDPTGATTGV
GKVFTDIVNRGGNVNILNWHNLKYKSFNVKARDFINGIPASPINGADAKLIFDDRLPYVV
SSHHQKTLAIVANESSSETDQPVAYVGGLDLANDRWDTIYHNNSALRDAAGITFKTQGWI
DGHVRIHGPAAKDVANNFVDRWNSDYLPSQGIVDDLLDFENPTCTDIPPLNYASSNTTGT
LGNQSVQITRTFSCKYKHYKEFAPRGETSLFRARVKAIKKAQNFIYVEDQYFILVPELLD
AIMEVMPRIQRLVVIANPQTKMLANGGYIKYLYEMVSPIREKYPDKFQIYTVKAERNLLI
HTKVVIIDDVYLSVGSANWNRRSMTSDTELNADIVDGDTVESPEGVTVGRLPRDFRVRKF
QEMTGRSYEELDGMTFVEAADQLRIAAADASTVLAKMEIEHHAYFALLTDLVRKVSDPQD
TCTYEEITE
Download sequence
Identical sequences G4ZMN2
67593.JGI140963 XP_009529416.1.77131 jgi|Physo1_1|140963|estExt_fgenesh1_pg.C_920026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]