SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|144723|estExt_fgenesh1_pg.C_2490006 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|144723|estExt_fgenesh1_pg.C_2490006
Domain Number 1 Region: 101-236
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.04e-21
Family Nuclease 0.034
Further Details:      
 
Domain Number 2 Region: 21-52
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000659
Family Nuclease 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|144723|estExt_fgenesh1_pg.C_2490006
Sequence length 329
Sequence
MGHDLPQQHRHPQGGNIPYRNNGWVDAHFRIHGPAAKEVANNFLQRWNSDYKPCQGLGDN
LLDFDNPDYEKLPPIDYASSNTTSKLGHQNRSHYEEFAPRGEQSLFKARLKALRNAKNFI
YIEDQYFIYVPELLDALMEVLPRIQRLIVLVQPPDTLLKASGYEKYLYEMIGPMKEKYPN
KVQIYTTKPELDIYIHTKLVLIDDVYVSLGSANWNRRSMTSDSELNANVIDDETVESPDG
VTVLKLARDMRIRKFVEMTRLSYKKLNAMKFIDAADQFKIAAKDESTILTDFSVKHHAYY
ITFVDVFREQVDPQEVCTFTEEGSKREIQ
Download sequence
Identical sequences jgi|Physo1_1|144723|estExt_fgenesh1_pg.C_2490006 67593.JGI144723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]