SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|156235|C_scaffold_15000005 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|156235|C_scaffold_15000005
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.21e-17
Family Thioltransferase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|156235|C_scaffold_15000005
Sequence length 120
Sequence
MELVTKVRDAEHWAQVLESSEKKLVVVDVHKDWCGPCKIVEPTYKRLATDIDHAERRLMF
TTLNVGLHIDGIEDTGSCKPRFLFFKDRKHIADVEGANAPQLELLVKQHLPPLGNDDEEA
Download sequence
Identical sequences G4YX04
XP_009520299.1.77131 67593.JGI156235 jgi|Physo1_1|156235|C_scaffold_15000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]