SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24375336|ref|NP_719379.1| from Shewanella oneidensis MR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24375336|ref|NP_719379.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-45
Family SMI1/KNR4-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24375336|ref|NP_719379.1|
Sequence length 135
Comment cell wall assembly/cell proliferation coordinating protein KNR4-like protein [Shewanella oneidensis MR-1]
Sequence
MHDIIEQLQERSETVPVPLELPTFEQLVEVEEQILIPLPRELKEYLLHASDVIYGVIEPV
TAADPYSHTYLPEVTCYAWSIGLPRDLIAICQLGDDFYCIDQDGQVHFWQNGDFTDTYWE
SFWEWVEDIWLKNKY
Download sequence
Identical sequences Q8EAQ0
NP_719379.1.27637 gi|24375336|ref|NP_719379.1| 211586.SO_3847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]