SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81230349|ref|YP_398727.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81230349|ref|YP_398727.1|
Domain Number 1 Region: 68-255
Classification Level Classification E-value
Superfamily MetI-like 1.44e-27
Family MetI-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81230349|ref|YP_398727.1|
Sequence length 266
Comment sulfonate ABC transporter, permease protein, putative [Synechococcus elongatus PCC 7942]
Sequence
MTISLRSRHRWFSALQQLAQSIPYPLRGLLLGLLLWSTLTSAWINPDPVWQAFAPESAIA
ALGKLLFNGTLWPHIGASLQRVAVGLLAAIAVGVPVGLLFGLVPMIERSASGALQFIRMI
SPLSWMPIAVMAFGIGDLPVYFLLAIAAVWPILLSTSSGTAAVNHKLLLLARSLCATRSE
TIRRIVIPAIVPQILVGVRLAIGTIWIVLVPAEMLGVSSGLGYFILDTRDRIAYNELTAV
LLAIGIIGCALDWSLQFLQKYWQPSR
Download sequence
Identical sequences Q9R6V0
1140.Synpcc7942_B2630 WP_011055170.1.45845 WP_011055170.1.95485 gi|47060338|ref|NP_665793.2|NC_004073 gi|81230349|ref|YP_398727.1|NC_007595 gi|81230349|ref|YP_398727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]